Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human IFNAR2 (Interferon alpha and beta receptor subunit 2) Expressed in NS0 for Antibody Discovery, Partial (27-243aa) (CAT#: MPX0585K)

This product is a 51.3 kDa Human IFNAR2 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IFNAR2
  • Protein Length
  • Partial (27-243aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 51.3 kDa
  • TMD
  • 1
  • Sequence
  • ISYDSPDYTDESCTFKISLRNFRS
    ILSWELKNHSIVPTHYTLLYTIMSKPEDLKVVKNCANTTRSFCDLTDEWR
    STHEAYVTVLEGFSGNTTLFSCSHNFWLAIDMSFEPPEFEIVGFTNHINV
    MVKFPSIVEEELQFDLSLVIEEQSEGIVKKHKPEIKGNMSGNFTYIIDKL
    IPNTNYCVSVYLEHSDEQAVIKSPLKCTLLPPGQESESAESAK

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in sterile PBS.
  • Endotoxin
  • <0.01 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • IFNAR2
  • Full Name
  • Interferon alpha and beta receptor subunit 2
  • Introduction
  • The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The protein belongs to the type II cytokine receptor family. Mutations in this gene are associated with Immunodeficiency 45.
  • Alternative Names
  • IFNAR2; IFN-R; IMD45; IFNABR; IFNARB; IFN-alpha-REC; interferon alpha/beta receptor 2; IFN-R-2; IFN-alpha/beta receptor 2; IFNalpha/beta receptor subunit 2; human interferon alpha/beta receptor; interferon (alpha, beta and omega) receptor 2; interferon alpha binding protein; interferon receptor; interferon-alpha/beta receptor beta chain; type I interferon receptor 2; Interferon alpha and beta receptor subunit 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us