Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human IFNGR1 (Interferon gamma receptor 1) Expressed in NS0 for Antibody Discovery, Partial (1-245aa) (CAT#: MPX0739K)

This product is a 25 kDa Human IFNGR1 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IFNGR1
  • Protein Length
  • Partial (1-245aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 25 kDa
  • TMD
  • 1
  • Sequence
  • MALLFLLPLVMQGVSRAEMGTADLGPSSVPTPTNVTIESYNMNPIVYWEY
    QIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWV
    RVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSV
    FVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQC
    QLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKG

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in sterile PBS.
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • IFNGR1
  • Full Name
  • Interferon gamma receptor 1
  • Introduction
  • This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.
  • Alternative Names
  • IFNGR1; CD119; IFNGR; IMD27A; IMD27B; AVP, type 2; CD119 antigen; CDw119; IFN-gamma receptor 1; IFN-gamma-R-alpha; IFN-gamma-R1; antiviral protein, type 2; immune interferon receptor 1; interferon-gamma receptor alpha chain; Interferon gamma receptor 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us