Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human IL1RL1 (Interleukin 1 receptor like 1) Expressed in NS0 for Antibody Discovery, Partial (19-328aa) (CAT#: MPX0599K)

This product is a 62.5 kDa Human IL1RL1 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IL1RL1
  • Protein Length
  • Partial (19-328aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 62.5 kDa
  • TMD
  • 1
  • Sequence
  • KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQ
    ERNRVFASGQLLKFLPAEVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYS
    TVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYT
    CKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFG
    KGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQ
    YDCLALNLHGLRRHTVRLSRKNPSKECF

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc and 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >97%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • IL1RL1
  • Full Name
  • Interleukin 1 receptor like 1
  • Introduction
  • The protein encoded by this gene is a member of the interleukin 1 receptor family. Studies of the similar gene in mouse suggested that this receptor can be induced by proinflammatory stimuli, and may be involved in the function of helper T cells. This gene, interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2) and interleukin 1 receptor-like 2 (IL1RL2) form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. Alternative splicing of this gene results in multiple transcript variants.
  • Alternative Names
  • IL1RL1; T1; ST2; DER4; ST2L; ST2V; FIT-1; IL33R; interleukin-1 receptor-like 1; growth stimulation-expressed; homolog of mouse growth stimulation-expressed; interleukin 1 receptor-related protein; Interleukin 1 receptor like 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us