Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human IL10RA (Interleukin 10 receptor subunit alpha) Expressed in HEK293 for Antibody Discovery, Partial (22-235aa) (CAT#: MPX0763K)

This product is a 51 kDa Human IL10RA membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IL10RA
  • Protein Length
  • Partial (22-235aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 51 kDa
  • TMD
  • 1
  • Sequence
  • HGTELPSPPSVWFEAEFFHHILHWTPIPN
    QSESTCYEVALLRYGIESWNSISNCSQTLSYDLTAVTLDLYHSNGYRARV
    RAVDGSRHSNWTVTNTRFSVDEVTLTVGSVNLEIHNGFILGKIQLPRPKM
    APANDTYESIFSHFREYEIAIRKVPGNFTFTHKKVKHENFSLLTSGEVGE
    FCVQVKPSVASRSNKGMWSKEECISLTRQYFTVTN

Product Description

  • Activity
  • Yes
  • Expression Systems
  • HEK293
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • IL10RA
  • Full Name
  • Interleukin 10 receptor subunit alpha
  • Introduction
  • The protein encoded by this gene is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammatory cytokines. This receptor is reported to promote survival of progenitor myeloid cells through the insulin receptor substrate-2/PI 3-kinase/AKT pathway. Activation of this receptor leads to tyrosine phosphorylation of JAK1 and TYK2 kinases. Two transcript variants, one protein-coding and the other not protein-coding, have been found for this gene.
  • Alternative Names
  • IL10RA; CD210; IL10R; CD210a; CDW210A; HIL-10R; IL-10R1; IL-10 receptor subunit alpha; IL-10R subunit 1; IL-10R subunit alpha; IL-10RA; interleukin 10 receptor, alpha; interleukin-10 receptor alpha chain; interleukin-10 receptor subunit 1; Interleukin 10 receptor subunit alpha

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us