Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human IL20RB (Interleukin 20 receptor subunit beta) Expressed in NS0 for Antibody Discovery, Partial (30-230aa) (CAT#: MPX0685K)

This product is a 49.2 kDa Human IL20RB membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IL20RB
  • Protein Length
  • Partial (30-230aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 49.2 kDa
  • TMD
  • 1
  • Sequence
  • DEVAILPAPQNLSVLSTNMKH
    LLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVT
    DDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGF
    HLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAA
    YCVKAQTFVKAIGRYSAFSQTECVEVQGEA

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • IL20RB
  • Full Name
  • Interleukin 20 receptor subunit beta
  • Introduction
  • IL20RB and IL20RA (MIM 605620) form a heterodimeric receptor for interleukin-20 (IL20; MIM 605619).
  • Alternative Names
  • IL20RB; DIRS1; FNDC6; IL-20R2; interleukin-20 receptor subunit beta; IL-20 receptor subunit beta; IL-20R-beta; IL-20RB; fibronectin type III domain containing 6; interleukin 20 receptor beta subunit; interleukin-20 receptor II; Interleukin 20 receptor subunit beta

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us