Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human IL5RA (Interleukin 5 receptor subunit alpha) Expressed in Baculovirus/Insect expression system for Antibody Discovery, Partial (21-335aa) (CAT#: MPX0737K)

This product is a 38 kDa Human IL5RA membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IL5RA
  • Protein Length
  • Partial (21-335aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 38 kDa
  • TMD
  • 1
  • Sequence
  • DLLPDEKISLLPPVNFTIKVTGLAQVLLQW
    KPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRT
    ILQNDHSLLASSWASAELHAPPGSPGTSIVNLTCTTNTTEDNYSRLRSYQ
    VSLHCTWLVGTDAPEDTQYFLYYRYGSWTEECQEYSKDTLGRNIACWFPR
    TFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQINPPLNVTAEIE
    GTRLSIQWEKPVSAFPIHCFDYEVKIHNTRNGYLQIEKLMTNAFISIIDD
    LSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGNDE

Product Description

  • Activity
  • Yes
  • Expression Systems
  • Baculovirus/Insect expression system
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >97%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • IL5RA
  • Full Name
  • Interleukin 5 receptor subunit alpha
  • Introduction
  • The protein encoded by this gene is an interleukin 5 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL5 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL5. This protein has been found to interact with syndecan binding protein (syntenin), which is required for IL5 mediated activation of the transcription factor SOX4. Several alternatively spliced transcript variants encoding four distinct isoforms have been reported.
  • Alternative Names
  • IL5RA; IL5R; CD125; CDw125; HSIL5R3; interleukin-5 receptor subunit alpha; CD125 antigen; IL-5 receptor subunit alpha; IL-5R subunit alpha; interleukin 5 receptor type 3; interleukin 5 receptor, alpha; interleukin-5 receptor alpha chain; Interleukin 5 receptor subunit alpha

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us