Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Rat Pmp22 (Peripheral myelin protein 22) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX0921K)

This product is a Rat Pmp22 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Rat
  • Target Protein
  • Pmp22
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • Molecular Weight
  • 23.4 kDa
  • TMD
  • 4
  • Sequence
  • MLLLLLGILFLHIAVLVLLFVSTIVSQWLVGNGHRTDLWQNCTTSALGAVQHCYSSSVSEWLQSVQATMILSVIFSVLSLFLFFCQLFTLTKGGRFYITGVFQILAGLCVMSAAAIYTVRHSEWHVNNDYSYGFAYILAWVAFPLALLSGIIYVILRKRE

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute protein in deionized sterile water
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • Pmp22
  • Full Name
  • Peripheral myelin protein 22
  • Introduction
  • mediates Schwann cell growth and peripheral myelin compaction; human homolog gene duplication causes Charcot-Marie-Tooth 1A (CMT1A) neuropathy.
  • Alternative Names
  • Pmp22; Gas-3; PMP-22; SAG; SR13 myelin protein; schwann cell membrane glycoprotein; Peripheral myelin protein 22

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us