Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human IL9R (Interleukin 9 receptor) Expressed in NS0 for Antibody Discovery, Partial (40-270aa) (CAT#: MPX0787K)

This product is a 27.4 kDa Human IL9R membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IL9R
  • Protein Length
  • Partial (40-270aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 27.4 kDa
  • TMD
  • 1
  • Sequence
  • VSVTGEGQGPR
    SRTFTCLTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGS
    ECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRRHVKLDPP
    SDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDH
    IVGVTWLILEAFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQ
    PVCFQAPQRQGPLIPPWGWP

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • 10xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 250 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS and NaCl.

Target

  • Target Protein
  • IL9R
  • Full Name
  • Interleukin 9 receptor
  • Introduction
  • The protein encoded by this gene is a cytokine receptor that specifically mediates the biological effects of interleukin 9 (IL9). The functional IL9 receptor complex requires this protein as well as the interleukin 2 receptor, gamma (IL2RG), a common gamma subunit shared by the receptors of many different cytokines. The ligand binding of this receptor leads to the activation of various JAK kinases and STAT proteins, which connect to different biologic responses. This gene is located at the pseudoautosomal regions of X and Y chromosomes. Genetic studies suggested an association of this gene with the development of asthma. Multiple pseudogenes on chromosome 9, 10, 16, and 18 have been described. Alternatively spliced transcript variants have been found for this gene.
  • Alternative Names
  • IL9R; CD129; IL-9R; interleukin-9 receptor; IL-9 receptor; Interleukin 9 receptor

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us