Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human IMMP2L (Inner mitochondrial membrane peptidase subunit 2) Full Length (CAT#: MPC2116K) Made to Order

This product is a 19.7 kDa Human IMMP2L membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IMMP2L
  • Protein Length
  • Full length
  • Protein Class
  • Protease
  • Molecular Weight
  • 19.7 kDa
  • TMD
  • 1
  • Sequence
  • MAQSQGWVKRYIKAFCKGFFVAVPVAVTFLDRVACVARVEGASMQPSLNP
    GGSQSSDVVLLNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALEGDI
    VRTIGHKNRYVKVPRGHIWVEGDHHGHSFDSNSFGPVSLGLLHAHATHIL
    WPPERWQKLESVLPPERLPVQREEE

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • IMMP2L
  • Full Name
  • Inner mitochondrial membrane peptidase subunit 2
  • Introduction
  • This gene encodes a protein involved in processing the signal peptide sequences used to direct mitochondrial proteins to the mitochondria. The encoded protein resides in the mitochondria and is one of the necessary proteins for the catalytic activity of the mitochondrial inner membrane peptidase (IMP) complex. Two variants that encode the same protein have been described for this gene.
  • Alternative Names
  • IMMP2L; IMP2; IMP2-LIKE; IMMP2L-IT1; mitochondrial inner membrane protease subunit 2; IMP2 inner mitochondrial membrane peptidase-like; IMP2 inner mitochondrial membrane protease-like; inner mitochondrial membrane peptidase 2 like; Inner mitochondrial membrane peptidase subunit 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us