Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human JAM2 (Junctional adhesion molecule 2) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, Partial (29-238aa) (CAT#: MPX4512K)

This product is a 27.5kDa Human JAM2 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • JAM2
  • Protein Length
  • Partial (29-238aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 27.5kDa
  • TMD
  • 1
  • Sequence
  • FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • JAM2
  • Full Name
  • Junctional adhesion molecule 2
  • Introduction
  • This gene belongs to the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. The protein encoded by this gene is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. It acts as an adhesive ligand for interacting with a variety of immune cell types, and may play a role in lymphocyte homing to secondary lymphoid organs. Alternatively spliced transcript variants have been found for this gene.
  • Alternative Names
  • JAM2; JAMB; CD322; IBGC8; JAM-B; VEJAM; PRO245; VE-JAM; C21orf43; JAM-2; JAM-IT/VE-JAM; vascular endothelial junction-associated molecule; Junctional adhesion molecule 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us