Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human JKAMP (JNK1/MAPK8 associated membrane protein) for Antibody Discovery (CAT#: MP0130X)

This product is a 61.6 kDa Human JKAMP membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • JKAMP
  • Protein Length
  • Full-length
  • Molecular Weight
  • 61.6 kDa
  • TMD
  • 7
  • Sequence
  • MAVDIQPACLGLYCGKTLLFKNGSTEIYGECGVCPRGQRTNAQKYCQPCTESPELYDWLYLGFMAMLPLVLHWFFIEWYSGKKSSSALFQHITALFECSMAAIITLLVSDPVGVLYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVFIYYAFCLVLMMLLRPLLVKKIACGLGKSDRFKSIYAALYFFPILTVLQAVGGGLLYYAFPYIILVLSLVTLAVYMSASEIENCYDLLVRKKRLIVLFSHWLLHAYGIISISRVDKLEQDLPLLALVPTPALFYLFTAKFTEPSRILSEGANGH

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • JKAMP
  • Full Name
  • JNK1/MAPK8 associated membrane protein
  • Introduction
  • JKAMP (JNK1/MAPK8 Associated Membrane Protein) is a Protein Coding gene. Diseases associated with JKAMP include Medulloblastoma and Large Cell Medulloblastoma. Among its related pathways are Factors and pathways affecting insulin-like growth factor (IGF1)-Akt signaling. Gene Ontology (GO) annotations related to this gene include ubiquitin protein ligase binding
  • Alternative Names
  • CDA06; HSPC213; HSPC327; JAMP; JNK1-associated membrane protein; medulloblastoma antigen MU-MB-50.4

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us