Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human KCNE5 (Potassium voltage-gated channel subfamily E regulatory subunit 5) Full Length (CAT#: MPC2219K) Made to Order

This product is a 14.9 kDa Human KCNE5 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCNE5
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • Molecular Weight
  • 14.9 kDa
  • TMD
  • 1
  • Sequence
  • MNCSESQRLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGRE
    VTSAKGDDAYLYILLIMIFYACLAGGLILAYTRSRKLVEAKDEPSQACAE
    HEWAPGGALTADAEAAAGSQAEGRRQLASEGLPALAQGAERV

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • KCNE5
  • Full Name
  • Potassium voltage-gated channel subfamily E regulatory subunit 5
  • Introduction
  • This gene encodes a member of a family of single pass transmembrane domain proteins that function as ancillary subunits to voltage-gated potassium channels. Members of this family affect diverse processes in potassium channel regulation, including ion selectivity, voltage dependence, and anterograde recycling from the plasma membrane. Variants of this gene are associated with idiopathic ventricular fibrillation and Brugada syndrome.
  • Alternative Names
  • KCNE5; KCNE1L; AMME syndrome candidate gene 2 protein; AMMECR2 protein; KCNE1-like; cardiac voltage-gated potassium channel accessory subunit 5; potassium channel subunit beta MiRP4; potassium voltage-gated channel subfamily E member 1-like protein; potassium voltage-gated channel, Isk-related family, member 1-like; Potassium voltage-gated channel subfamily E regulatory subunit 5

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us