Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human KCNJ9 (Potassium inwardly rectifying channel subfamily J member 9) for Antibody Discovery (CAT#: MP1243J)

This product is a 43.8 kDa Human KCNJ9 membrane protein expressed in HEK293T. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCNJ9
  • Protein Length
  • Full-length
  • Protein Class
  • Druggable Genome, Ion Channels: Potassium, Transmembrane
  • Molecular Weight
  • 43.8 kDa
  • TMD
  • 2
  • Sequence
  • MAQENAAFSPGQEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLSLLFFVLAYAL
    TWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETTIGYGHRVITDQCPEGIVLLL
    LQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVSLRDGRLCLMFRVGDLRSSHIVEASIRAKLI
    RSRQTLEGEFIPLHQTDLSVGFDTGDDRLFLVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMV
    EATGMTCQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLY
    WSIPSRLDEKVEEEGAGEGAGGEAGADKEQNGCLPPPESESKV

Product Description

  • Expression Systems
  • HEK293T
  • Tag
  • C-Myc/DDK
  • Purification
  • Anti-DDK affinity column followed by conventional chromatography steps
  • Purity
  • > 80% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Target

  • Target Protein
  • KCNJ9
  • Full Name
  • Potassium inwardly rectifying channel subfamily J member 9
  • Introduction
  • Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins. It associates with another G-protein-activated potassium channel to form a heteromultimeric pore-forming complex.
  • Alternative Names
  • GIRK3; KIR3.3; G protein-activated inward rectifier potassium channel 3; G protein-coupled inward rectifier potassium channel; inward rectifier K(+) channel Kir3.3; potassium channel, inwardly rectifying subfamily J member 9; inwardly rectifier K+ channel KIR3.3

Case Studies

Customer reviews and Q&As    

Related Products
  • CAT
  • Product Name
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us