Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human KCNK1 (Potassium two pore domain channel subfamily K member 1) Full Length (CAT#: MPC0616K) Made to Order

This product is a 38.1 kDa Human KCNK1 membrane protein expressed in Komagataella pastoris. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCNK1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 38.1 kDa
  • TMD
  • 4
  • Sequence
  • MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYED
    LLRQELRKLKRRFLEEHECLSEQQLEQFLGRVLEASNYGVSVLSNASGNW
    NWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLT
    AVVQRITVHVTRRPVLYFHIRWGFSKQVVAIVHAVLLGFVTVSCFFFIPA
    AVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGIT
    CYLLLGLIAMLVVLETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLS
    FSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH

Product Description

  • Expression Systems
  • Komagataella pastoris
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • KCNK1
  • Full Name
  • Potassium two pore domain channel subfamily K member 1
  • Introduction
  • This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.
  • Alternative Names
  • DPK; HOHO; K2P1; KCNO1; TWIK1; K2p1.1; TWIK-1; potassium channel subfamily K member 1; inward rectifying potassium channel protein TWIK-1; potassium channel K2P1; potassium channel KCNO1; potassium channel, two pore domain subfamily K, member 1; potassium inwardly-rectifying channel, subfamily K, member 1; tandem of P domains in a weak inward rectifying K+ channel 1; KCNK1; Potassium two pore domain channel subfamily K member 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us