Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human KCNK18 (Potassium two pore domain channel subfamily K member 18) Full Length (CAT#: MPC0623K) Made to Order

This product is a 43.6 kDa Human KCNK18 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCNK18
  • Protein Length
  • Full length
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 43.6 kDa
  • TMD
  • 4
  • Sequence
  • MEVSGHPQARRCCPEALGKLFPGLCFLCFLVTYALVGAVVFSAIEDGQVL
    VAADDGEFEKFLEELCRILNCSETVVEDRKQDLQGHLQKVKPQWFNRTTH
    WSFLSSLFFCCTVFSTVGYGYIYPVTRLGKYLCMLYALFGIPLMFLVLTD
    TGDILATILSTSYNRFRKFPFFTRPLLSKWCPKSLFKKKPDPKPADEAVP
    QIIISAEELPGPKLGTCPSRPSCSMELFERSHALEKQNTLQLPPQAMERS
    NSCPELVLGRLSYSIISNLDEVGQQVERLDIPLPIIALIVFAYISCAAAI
    LPFWETQLDFENAFYFCFVTLTTIGFGDTVLEHPNFFLFFSIYIIVGMEI
    VFIAFKLVQNRLIDIYKNVMLFFAKGKFYHLVKK

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • KCNK18
  • Full Name
  • Potassium two pore domain channel subfamily K member 18
  • Introduction
  • Potassium channels play a role in many cellular processes including maintenance of the action potential, muscle contraction, hormone secretion, osmotic regulation, and ion flow. This gene encodes a member of the superfamily of potassium channel proteins containing two pore-forming P domains and the encoded protein functions as an outward rectifying potassium channel. A mutation in this gene has been found to be associated with migraine with aura.
  • Alternative Names
  • TRIK; MGR13; TRESK; TRESK2; K2p18.1; TRESK-2; potassium channel subfamily K member 18; TWIK-related individual K+ channel; TWIK-related individual potassium channel; TWIK-related spinal cord K+ channel; TWIK-related spinal cord potassium channel; potassium channel, subfamily K, member 18; potassium channel, two pore domain subfamily K, member 18; KCNK18; Potassium two pore domain channel subfamily K member 18

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us