Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human KCNK3 (Potassium two pore domain channel subfamily K member 3) Full Length (CAT#: MPC0625K) Made to Order

This product is a 43.5 kDa Human KCNK3 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCNK3
  • Protein Length
  • Full length
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 43.5 kDa
  • TMD
  • 4
  • Sequence
  • MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPELIERQRLELRQQELRA
    RYNLSQGGYEELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAA
    PSTDGGKVFCMFYALLGIPLTLVMFQSLGERINTLVRYLLHRAKKGLGMR
    RADVSMANMVLIGFFSCISTLCIGAAAFSHYEHWTFFQAYYYCFITLTTI
    GFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLNLVVLRFMTMN
    AEDEKRDAEHRALLTRNGQAGGGGGGGSAHTTDTASSTAAAGGGGFRNVY
    AEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEQSHSSPGGG
    GRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGLMKRRSSV

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • KCNK3
  • Full Name
  • Potassium two pore domain channel subfamily K member 3
  • Introduction
  • This gene encodes a member of the superfamily of potassium channel proteins that contain two pore-forming P domains. The encoded protein is an outwardly rectifying channel that is sensitive to changes in extracellular pH and is inhibited by extracellular acidification. Also referred to as an acid-sensitive potassium channel, it is activated by the anesthetics halothane and isoflurane. Although three transcripts are detected in northern blots, there is currently no sequence available to confirm transcript variants for this gene.
  • Alternative Names
  • OAT1; PPH4; TASK; TASK1; TBAK1; K2p3.1; TASK-1; potassium channel subfamily K member 3; TWIK-related acid-sensitive K(+) channel 1; TWIK-related acid-sensitive K+ 1; TWIK-related; acid-sensitive K+ channel; acid-sensitive potassium channel protein TASK; acid-sensitive potassium channel protein TASK-1; cardiac potassium channel; potassium channel, two pore domain subfamily K, member 3; potassium inwardly-rectifying channel, subfamily K, member 3; two P domain potassium channel; two pore K(+) channel KT3.1; two pore potassium channel KT3.1; KCNK3; Potassium two pore domain channel subfamily K member 3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us