Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human KCNMB2 (Potassium calcium-activated channel subfamily M regulatory beta subunit 2) Full Length (CAT#: MPC0633K) Made to Order

This product is a 27.1 kDa Human KCNMB2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCNMB2
  • Protein Length
  • Full length
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 27.1 kDa
  • TMD
  • 2
  • Sequence
  • MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILL
    GLAMMVCSIMMYFLLGITLLRSYMQSVWTEESQCTLLNASITETFNCSFS
    CGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQKCSYIPKCGK
    NFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTKLYSSNVLFHSL
    FWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • KCNMB2
  • Full Name
  • Potassium calcium-activated channel subfamily M regulatory beta subunit 2
  • Introduction
  • MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which decreases the activation time of MaxiK alpha subunit currents. Alternative splicing results in multiple transcript variants of this gene. Additional variants are discussed in the literature, but their full length nature has not been described.
  • Alternative Names
  • Calcium-activated potassium channel subunit beta-2; BK channel beta subunit 2; BK channel subunit beta-2; MaxiK channel beta 2 subunit; MaxiK channel beta-subunit 2; big potassium channel beta subunit 2; charybdotoxin receptor subunit beta-2; hCG1646471; hbeta2; k(VCA)beta-2; large conductance calcium-activated potassium channel beta 2 subunit; large-conductance Ca2+-activated K+ channel beta2 subunit; potassium channel subfamily M regulatory beta subunit 2; potassium large conductance calcium-activated channel, subfamily M, beta member 2; slo-beta-2; KCNMB2; Potassium calcium-activated channel subfamily M regulatory beta subunit 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us