Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human KCNS3 (Potassium voltage-gated channel modifier subfamily S member 3) Full Length (CAT#: MPC0642K) Made to Order

This product is a 56 kDa Human KCNS3 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCNS3
  • Protein Length
  • Full length
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 56 kDa
  • TMD
  • 6
  • Sequence
  • MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSE
    EAILELCDDYSVADKEYYFDRNPSLFRYVLNFYYTGKLHVMEELCVFSFC
    QEIEYWGINELFIDSCCSNRYQERKEENHEKDWDQKSHDVSTDSSFEESS
    LFEKELEKFDTLRFGQLRKKIWIRMENPAYCLSAKLIAISSLSVVLASIV
    AMCVHSMSEFQNEDGEVDDPVLEGVEIACIAWFTGELAVRLAAAPCQKKF
    WKNPLNIIDFVSIIPFYATLAVDTKEEESEDIENMGKVVQILRLMRIFRI
    LKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEKDDH
    TSSLTSIPICWWWATISMTTVGYGDTHPVTLAGKLIASTCIICGILVVAL
    PITIIFNKFSKYYQKQKDIDVDQCSEDAPEKCHELPYFNIRDIYAQRMHT
    FITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLENCTAK

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • KCNS3
  • Full Name
  • Potassium voltage-gated channel modifier subfamily S member 3
  • Introduction
  • Voltage-gated potassium channels form the largest and most diversified class of ion channels and are present in both excitable and nonexcitable cells. Their main functions are associated with the regulation of the resting membrane potential and the control of the shape and frequency of action potentials. The alpha subunits are of 2 types: those that are functional by themselves and those that are electrically silent but capable of modulating the activity of specific functional alpha subunits. The protein encoded by this gene is not functional by itself but can form heteromultimers with member 1 and with member 2 (and possibly other members) of the Shab-related subfamily of potassium voltage-gated channel proteins. This gene belongs to the S subfamily of the potassium channel family. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
  • Alternative Names
  • KV9.3; potassium voltage-gated channel subfamily S member 3; Shab-related delayed-rectifier K+ channel alpha subunit 3; delayed-rectifier K(+) channel alpha subunit 3; potassium voltage-gated channel delayed-rectifier protein S3; potassium voltage-gated channel, delayed-rectifier, subfamily S, member 3; voltage-gated potassium channel protein Kv9.3; voltage-gated potassium channel subunit Kv9.3; KCNS3; Potassium voltage-gated channel modifier subfamily S member 3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us