Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human KLRC4-KLRK1 (KLRC4-KLRK1 readthrough) Full Length (CAT#: MPC3692K) Made to Order

This product is a made-to-order Human KLRC4-KLRK1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KLRC4-KLRK1
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • XEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKT
    YHCKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLN
    RRMQKARHCGHCPEEWITYSNSCYYIGKERRTWEERVCWPVLRRTLICFL

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • KLRC4-KLRK1
  • Full Name
  • KLRC4-KLRK1 readthrough
  • Introduction
  • This locus represents naturally occurring read-through transcription between the neighboring KLRC4 (killer cell lectin-like receptor subfamily C, member 4) and KLRK1 (killer cell lectin-like receptor subfamily K, member 1) genes on chromosome 12. The read-through transcript includes an alternate 5' exon and lacks a significant portion of the KLRC4 coding sequence, including the start codon, and it thus encodes the KLRK1 protein.
  • Alternative Names
  • KLRC4-KLRK1; NKG2-D type II integral membrane protein; NK cell receptor D; NKG2-D-activating NK receptor; killer cell lectin-like receptor subfamily K member 1; KLRC4-KLRK1 readthrough

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us