Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human KLRD1 (Killer cell lectin like receptor D1) Expressed in CHO for Antibody Discovery, Partial (32-179aa) (CAT#: MPX0326K)

This product is a 18 kDa Human KLRD1 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KLRD1
  • Protein Length
  • Partial (32-179aa)
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 18 kDa
  • TMD
  • 1
  • Sequence
  • KNSFTKLSIEPAFTPGPNI
    ELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQ
    NTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTK
    NCIAYNPNGNALDESCEDKNRYICKQQLI

Product Description

  • Expression Systems
  • CHO
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 200 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.

Target

  • Target Protein
  • KLRD1
  • Full Name
  • Killer cell lectin like receptor D1
  • Introduction
  • Natural killer (NK) cells are a distinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immune stimulation. Several genes of the C-type lectin superfamily, including members of the NKG2 family, are expressed by NK cells and may be involved in the regulation of NK cell function. KLRD1 (CD94) is an antigen preferentially expressed on NK cells and is classified as a type II membrane protein because it has an external C terminus. Several transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • KLRD1; CD94; natural killer cells antigen CD94; CD94 antigen; KP43; NK cell receptor; killer cell lectin-like receptor subfamily D, member 1; Killer cell lectin like receptor D1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us