Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human LHFPL4 (LHFPL tetraspan subfamily member 4) Full Length (CAT#: MPC3025K) Made to Order

This product is a made-to-order Human LHFPL4 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • LHFPL4
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • TMD
  • 4
  • Sequence
  • MLPSQEASKLYHEHYMRNSRAIGVLWAIFTICFAIINVVVFIQPYWVGDS
    VSTPKPGYFGLFHYCVGSGLAGRELTCRGSFTDFSTIPSSAFKAAAFFVL
    LSMVLILGCITCFSLFFFCNTATVYKICAWMQLLAALCLVLGCMIFPDGW
    DAETIRDMCGAKTGKYSLGDCSVRWAYILAIIGILNALILSFLAFVLGNR
    QTDLLQEELKPENKDFVGSTVSSVLRPGGDVSGWGVLPCPVAHSQGP

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • LHFPL4
  • Full Name
  • LHFPL tetraspan subfamily member 4
  • Introduction
  • This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. Mutations in one LHFP-like gene result in deafness in humans and mice, and a second LHFP-like gene is fused to a high-mobility group gene in a translocation-associated lipoma.
  • Alternative Names
  • LHFPL4; GARLH4; LHFPL tetraspan subfamily member 4 protein; GABAA receptor regulatory Lhfpl4; LHFP-like protein 4; lipoma HMGIC fusion partner-like 4 protein; LHFPL tetraspan subfamily member 4

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us