Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human LHFPL6 (LHFPL tetraspan subfamily member 6) Full Length (CAT#: MPC3091K) Made to Order

This product is a made-to-order Human LHFPL6 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • LHFPL6
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 3
  • Sequence
  • MASSLTCTGVIWALLSFLCAATSCVGFFMPYWLWGSQLGKPVSFGTFRRC
    SYPVHDESRQMMVMVEECGRYASFQGIPSAEWRICTIVTGLGCGLLLLVA
    LTALMGCCVSDLISRTVGRVAGGIQFLGGLLIGAGCALYPLGWDSEEVRQ
    TCGYTSGQFDLGKCEIGWAYYCTGAGATAAMLLCTWLACFSGKKQKHYPY

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • LHFPL6
  • Full Name
  • LHFPL tetraspan subfamily member 6
  • Introduction
  • This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. This gene is fused to a high-mobility group gene in a translocation-associated lipoma. Mutations in another LHFP-like gene result in deafness in humans and mice. Alternatively spliced transcript variants have been found; however, their full-length nature is not known.
  • Alternative Names
  • LHFPL6; LHFP; LHFPL tetraspan subfamily member 6 protein; lipoma HMGIC fusion partner; LHFPL tetraspan subfamily member 6

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us