Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human LILRB3 (Leukocyte immunoglobulin like receptor B3) Expressed in NS0 for Antibody Discovery, Partial (24-443aa) (CAT#: MPX0337K)

This product is a 72.6 kDa Human LILRB3 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • LILRB3
  • Protein Length
  • Partial (24-443aa)
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 72.6 kDa
  • TMD
  • 1
  • Sequence
  • GPFPKPTLWAEPGSVISWGSPVTIWCQ
    GSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHY
    YSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGY
    HHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYY
    TNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVG
    YNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAH
    NLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQ
    FDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSY
    SSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Product Description

  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 250 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • LILRB3
  • Full Name
  • Leukocyte immunoglobulin like receptor B3
  • Introduction
  • This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • LILRB3; HL9; ILT5; LIR3; PIRB; CD85A; ILT-5; LIR-3; PIR-B; LILRA6; leukocyte immunoglobulin-like receptor subfamily B member 3; CD85 antigen-like family member A; immunoglobulin-like transcript 5; leucocyte Ig-like receptor B3; leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 3; monocyte inhibitory receptor HL9; Leukocyte immunoglobulin like receptor B3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us