Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human LYVE1 (Lymphatic vessel endothelial hyaluronan receptor 1) for Antibody Discovery (CAT#: MP0154Q)

This product is a 45 kDa Human LYVE1 membrane protein expressed in Insect. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • LYVE1
  • Protein Length
  • Full-length
  • Protein Class
  • Druggable Genome, Transmembrane
  • Molecular Weight
  • 45 kDa
  • TMD
  • 1
  • Sequence
  • MARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGGVPTALLVLALLFFGAAAGLGFCYVKRYVKAFPFTNKNQQKEMIETKVVKEEKANDSNPNEESKKTDKNPEESKSPSKTTVRCLEAEV

Product Description

  • Expression Systems
  • Insect
  • Tag
  • His
  • Endotoxin
  • < 0.1 ng per µg
  • Purity
  • >95% by SDS-PAGE and visualised by silver stain
  • Buffer
  • PBS

Target

  • Target Protein
  • LYVE1
  • Full Name
  • Lymphatic vessel endothelial hyaluronan receptor 1
  • Introduction
  • This gene encodes a type I integral membrane glycoprotein. The encoded protein acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis.
  • Alternative Names
  • lymphatic vessel endothelial hyaluronic acid receptor 1; LYVE-1; Cell surface retention sequence-binding protein 1; cell surface retention sequence binding protein-1; extracellular link domain-containing 1; extracellular link domain-containing protein 1; Hyaluronic acid receptor; CRSBP-1; HAR; XLKD1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us