Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TOMM20 (Translocase of outer mitochondrial membrane 20) Full Length (CAT#: MPC2203K) Made to Order

This product is a 16.2 kDa Human TOMM20 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TOMM20
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 16.2 kDa
  • TMD
  • 1
  • Sequence
  • MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKE
    RAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVC
    GQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • TOMM20
  • Full Name
  • Translocase of outer mitochondrial membrane 20
  • Alternative Names
  • TOMM20; MAS20; MOM19; TOM20; mitochondrial import receptor subunit TOM20 homolog; mitochondrial 20 kDa outer membrane protein; outer mitochondrial membrane receptor Tom20; translocase of outer mitochondrial membrane 20 homolog type II; Translocase of outer mitochondrial membrane 20

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us