Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human MDK (Midkine) expressed in E. coli for Antibody Discovery (CAT#: MP0004Q)

This product is a 15.7 kDa Human MDK membrane protein expressed in E. coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MDK
  • Protein Length
  • Partial
  • Protein Class
  • Druggable Genome, Secreted Protein, Transmembrane
  • Molecular Weight
  • 15.7 kDa
  • Sequence
  • MVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Product Description

  • Expression Systems
  • E. coli
  • Tag
  • His
  • Endotoxin
  • < 1 EU/µg
  • Purification
  • Conventional chromatography
  • Purity
  • >90% by SDS - PAGE
  • Buffer
  • 20 mM Tris-HCl buffer (pH 8.0) containing 0.1 M NaCl, 2 mM DTT, and 20% Glycerol

Target

  • Target Protein
  • MDK
  • Full Name
  • Midkine
  • Introduction
  • This gene encodes a member of a small family of secreted growth factors that binds heparin and responds to retinoic acid. The encoded protein promotes cell growth, migration, and angiogenesis, in particular during tumorigenesis. This gene has been targeted as a therapeutic for a variety of different disorders. Alternatively spliced transcript variants encoding multiple isoforms have been observed.
  • Alternative Names
  • ARAP; MK; NEGF2; midkine; amphiregulin-associated protein; midgestation and kidney protein; neurite growth-promoting factor 2; retinoic acid inducible factor; Neurite outgrowth-promoting protein

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us