Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human MICB (MHC class I polypeptide-related sequence B) Expressed in CHO for Antibody Discovery, Partial (23-308aa) (CAT#: MPX0725K)

This product is a 33 kDa Human MICB membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MICB
  • Protein Length
  • Partial (23-308aa)
  • Protein Class
  • Immunity
  • Molecular Weight
  • 33 kDa
  • TMD
  • 1
  • Sequence
  • AEPHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYD
    RQKRRAKPQGQWAENVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCE
    IHEDSSTRGSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHY
    RAMQADCLQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWR
    QDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKA
    LVLQSQRT

Product Description

  • Activity
  • Yes
  • Expression Systems
  • CHO
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • MICB
  • Full Name
  • MHC class I polypeptide-related sequence B
  • Introduction
  • This gene encodes a heavily glycosylated protein which is a ligand for the NKG2D type II receptor. Binding of the ligand activates the cytolytic response of natural killer (NK) cells, CD8 alphabeta T cells, and gammadelta T cells which express the receptor. This protein is stress-induced and is similar to MHC class I molecules; however, it does not associate with beta-2-microglobulin or bind peptides. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • MICB; PERB11.2; MHC class I antigen-related protein B; MHC class I chain-related protein B; MHC class I mic-B antigen; MHC class I-like molecule PERB11.2-IMX; stress inducible class I homolog; MHC class I polypeptide-related sequence B

Case Studies

Customer reviews and Q&As    

Related Products
  • CAT
  • Product Name
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us