Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human MINOS1 (Mitochondrial contact site and cristae organizing system subunit 10) Full Length (CAT#: MPC4743K) Made to Order

This product is a made-to-order Human MINOS1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MINOS1
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMG
    LGMAYSNCQHDFQAPYLLHGKYVKEQEQ

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • MINOS1
  • Full Name
  • Mitochondrial contact site and cristae organizing system subunit 10
  • Alternative Names
  • MINOS1; MIO10; Mic10; MINOS1; C1orf151; MICOS complex subunit MIC10; RP5-1056L3.2; UPF0327 protein C1orf151; mitochondrial inner membrane organizing system 1; mitochondrial inner membrane organizing system protein 1; Mitochondrial contact site and cristae organizing system subunit 10

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us