Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human MOG (Myelin oligodendrocyte glycoprotein) expressed in E.coli for Antibody Discovery (CAT#: MP1302J)

This product is a 15.2 kDa Human MOG membrane protein expressed in E. coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MOG
  • Protein Length
  • Partial (30-154aa)
  • Protein Class
  • Transmembrane
  • Molecular Weight
  • 15.2 kDa
  • TMD
  • 2
  • Sequence
  • GQFRVIGPRHPIRALVGDEVELPCRISPGKN
    ATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFS
    DEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG

Product Description

  • Expression Systems
  • E. coli
  • Tag
  • Tag Free
  • Endotoxin
  • < 0.1 EU/µg
  • Purity
  • >95% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 0.2 µM filtered solution of 20mM HAc-NaAc, 150mM NaCl, pH 4.5

Target

  • Target Protein
  • MOG
  • Full Name
  • Myelin oligodendrocyte glycoprotein
  • Introduction
  • The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.
  • Alternative Names
  • BTN6; BTNL11; MOGIG2; NRCLP7; MOG AluA; MOG AluB; MOG Ig-AluB; MOG alpha-5; celiac disease 3; cytotoxic T lymphocyte associated antigen 4 short spliced form; cytotoxic T-lymphocyte-associated serine esterase-4; insulin-dependent diabetes mellitus 12

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us