Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human MPC1 (Mitochondrial pyruvate carrier 1) Full Length (CAT#: MPC2206K) Made to Order

This product is a 12.3 kDa Human MPC1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MPC1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 12.3 kDa
  • TMD
  • 2
  • Sequence
  • MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEI
    ISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHATNEVAQLIQGGRLIK
    HEMTKTASA

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • MPC1
  • Full Name
  • Mitochondrial pyruvate carrier 1
  • Introduction
  • The protein encoded by this gene is part of an MPC1/MPC2 heterodimer that is responsible for transporting pyruvate into mitochondria. The encoded protein is found in the inner mitochondrial membrane. Defects in this gene are a cause of mitochondrial pyruvate carrier deficiency. Several transcript variants, some protein coding and one non-protein coding, have been found for this gene.
  • Alternative Names
  • MPC1; MPYCD; BRP44L; CGI-129; SLC54A1; HSPC040 protein; brain protein 44-like protein; Mitochondrial pyruvate carrier 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us