Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human MTFP1 (Mitochondrial fission process 1) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX1248K)

This product is a Human MTFP1 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MTFP1
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • TMD
  • 3
  • Sequence
  • MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis and SUMO tag
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • MTFP1
  • Full Name
  • Mitochondrial fission process 1
  • Introduction
  • MTP18 is a mitochondrial protein and downstream target of the phosphatidylinositol 3-kinase (see PIK3CA, MIM 171834) signaling pathway that plays a role in cell viability and mitochondrial dynamics.
  • Alternative Names
  • MTFP1; MTP18; HSPC242; mitochondrial 18 kDa protein; mitochondrial fission protein MTP18; mitochondrial protein 18 kDa; Mitochondrial fission process 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us