Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human MUCL3 (Mucin like 3) for Antibody Discovery (CAT#: MP0304X)

This product is a 52.1 kDa Human MUCL3 membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MUCL3
  • Protein Length
  • Full-length
  • Molecular Weight
  • 52.1 kDa
  • TMD
  • 1
  • Sequence
  • MTQVTEKSTEHPEKTTSTTEKTTRTPEKPTLYSEKTICTKGKNTPVPEKPTENLGNTTLTTETIKAPVKSTENPEKTAAVTKTIKPSVKVTGDKSLTTTSSHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQKGIHAGQMGENDSFPAWAIVIVVLVAVILLLVFLGLIFLVSYMMRTRRTLTQNTQYNDAEDEGGPNSYPVYLMEQQNLGMGQIPSPR

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • MUCL3
  • Full Name
  • Mucin like 3
  • Introduction
  • The gene DPCR1 (diffuse panbronchiolitis critical region 1), located in the major histocompatibility complex class I, encodes a 235-amino acid protein that shares homology with the mucin-like domain of sperm multiple-domain transmembrane protein called zonadhesin, which has the ability to bind to sperm zona pellucida
  • Alternative Names
  • MGC126710; MGC126712; PBLT; bCX105N19.6; OTTHUMP00000062447; diffuse panbronchiolitis critical region 1 protein

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us