Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human NAT8 (N-acetyltransferase 8 (putative)) Full Length (CAT#: MPC4827K) Made to Order

This product is a made-to-order Human NAT8 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NAT8
  • Protein Length
  • Full length
  • Protein Class
  • Transferase
  • TMD
  • 1
  • Sequence
  • MAPCHIRKYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGP
    LALLLVSGSWLLALVFSISLFPALWFLAKKPWTEYVDMTLCTDMSDITKS
    YLSERGSCFWVAESEEKVVGMVGALPVDDPTLREKRLQLFHLFVDSEHRR
    QGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSF
    FCVWARLVALHTVHFIYHLPSSKVGSL

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • NAT8
  • Full Name
  • N-acetyltransferase 8 (putative)
  • Introduction
  • This gene, isolated using the differential display method to detect tissue-specific genes, is specifically expressed in kidney and liver. The encoded protein shows amino acid sequence similarity to N-acetyltransferases. A similar protein in Xenopus affects cell adhesion and gastrulation movements, and may be localized in the secretory pathway. A highly similar paralog is found in a cluster with this gene.
  • Alternative Names
  • NAT8; GLA; CML1; CCNAT; Hcml1; ATase2; TSC501; TSC510; N-acetyltransferase 8; acetyltransferase 2; camello-like protein 1; cysteinyl-conjugate N-acetyltransferase; kidney- and liver-specific gene product; probable N-acetyltransferase 8; N-acetyltransferase 8 (putative)

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us