Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human NCR2 (Natural cytotoxicity triggering receptor 2) Expressed in NS0 for Antibody Discovery, Partial (22-190aa) (CAT#: MPX0327K)

This product is a 45 kDa Human NCR2 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NCR2
  • Protein Length
  • Partial (22-190aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 45 kDa
  • TMD
  • 1
  • Sequence
  • QSKAQVLQSVAGQTLTVRCQYPPTGSLYE
    KKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLR
    EEDSGHYWCRIYRPSDNSVSKSVRFYLVVSPASASTQTSWTPRDLVSSQT
    QTQSCVPPTAGARQAPESPSTIPVPSQPQNSTLRPGPAAP

Product Description

  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.01 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • NCR2
  • Full Name
  • Natural cytotoxicity triggering receptor 2
  • Alternative Names
  • NCR2; LY95; CD336; NKP44; NK-p44; dJ149M18.1; NK cell activating receptor (NKp44); NK cell-activating receptor; lymphocyte antigen 95 (activating NK-receptor; NK-p44); lymphocyte antigen 95 homolog (activating NK-receptor; NK-p44); natural killer cell p44-related protein; Natural cytotoxicity triggering receptor 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us