Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human NCR3 (Natural cytotoxicity triggering receptor 3) Full Length (CAT#: MPC3642K) Made to Order

This product is a made-to-order Human NCR3 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NCR3
  • Protein Length
  • Full length
  • Protein Class
  • Receptor; Immunity
  • TMD
  • 1
  • Sequence
  • MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAI
    GSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRG
    HDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVS
    FLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPG
    G

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • NCR3
  • Full Name
  • Natural cytotoxicity triggering receptor 3
  • Introduction
  • The protein encoded by this gene is a natural cytotoxicity receptor (NCR) that may aid NK cells in the lysis of tumor cells. The encoded protein interacts with CD3-zeta (CD247), a T-cell receptor. A single nucleotide polymorphism in the 5' untranslated region of this gene has been associated with mild malaria suceptibility. Three transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • NCR3; 1C7; MALS; CD337; LY117; NKp30; NK-p30; activating NK-A1 receptor; activating natural killer receptor p30; lymphocyte antigen 117; natural killer cell p30-related protein; Natural cytotoxicity triggering receptor 3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us