Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human NDFIP1 (Nedd4 family interacting protein 1) Full Length (CAT#: MPC3064K) Made to Order

This product is a made-to-order Human NDFIP1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDFIP1
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 3
  • Sequence
  • MALALAALAAVEPACGSRYQQLQNEEESGEPEQAAGDAPPPYSSISAESA
    AYFDYKDESGFPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVG
    RDDFDDADQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYGAI
    SGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYA
    KVRKMPETFSNLPRTRVLFIY

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • NDFIP1
  • Full Name
  • Nedd4 family interacting protein 1
  • Introduction
  • The protein encoded by this gene belongs to a small group of evolutionarily conserved proteins with three transmembrane domains. It is a potential target for ubiquitination by the Nedd4 family of proteins. This protein is thought to be part of a family of integral Golgi membrane proteins.
  • Alternative Names
  • NDFIP1; N4WBP5; NEDD4 family-interacting protein 1; Nedd4 WW domain-binding protein 5; breast cancer-associated protein SGA-1M; putative MAPK-activating protein PM13; putative NF-kappa-B-activating protein 164; putative NFKB and MAPK-activating protein; Nedd4 family interacting protein 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us