Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human NDUFA11 (NADH:ubiqui oxidoreductase subunit A11) for Antibody Discovery (CAT#: MP0760X)

This product is a 41.3 kDa Human NDUFA11 membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDUFA11
  • Protein Length
  • Full-length
  • Molecular Weight
  • 41.3 kDa
  • TMD
  • 2
  • Sequence
  • MAPKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTFTAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGIAASLVKMGRLEGWEVFAKPKV

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • NDUFA11
  • Full Name
  • NADH:ubiqui oxidoreductase subunit A11
  • Introduction
  • This gene encodes a subunit of the membrane-bound mitochondrial complex I. Complex I is composed of numerous subunits and functions as the NADH-ubiquinol reductase of the mitochondrial electron transport chain. Mutations in this gene are associated with severe mitochondrial complex I deficiency. Alternate splicing results in multiple transcript variants.
  • Alternative Names
  • B14.7; MC1DN14; CI-B14.7; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 11, 14.7kDa; NADH-ubiquinone oxidoreductase subunit B14.7; complex I B14.7 subunit; NADH-ubiquinone oxidoreductase subunit B14.7

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us