Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human NDUFA11 (NADH:ubiquinone oxidoreductase subunit A11) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX1145K)

This product is a Human NDUFA11 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDUFA11
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Transport
  • TMD
  • 2
  • Sequence
  • APKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTFTAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGIAASLVKMGRLEGWEVFAKPKV

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • NDUFA11
  • Full Name
  • NADH:ubiquinone oxidoreductase subunit A11
  • Introduction
  • This gene encodes a subunit of the membrane-bound mitochondrial complex I. Complex I is composed of numerous subunits and functions as the NADH-ubiquinol reductase of the mitochondrial electron transport chain. Mutations in this gene are associated with severe mitochondrial complex I deficiency. Alternate splicing results in multiple transcript variants.
  • Alternative Names
  • NDUFA11; B14.7; MC1DN14; CI-B14.7; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 11, 14.7kDa; NADH-ubiquinone oxidoreductase subunit B14.7; complex I B14.7 subunit; NADH:ubiquinone oxidoreductase subunit A11

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us