Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human NDUFAB1 (NADH:ubiqui oxidoreductase subunit AB1) for Antibody Discovery (CAT#: MP0769X)

This product is a 42.9 kDa Human NDUFAB1 membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDUFAB1
  • Protein Length
  • Full-length
  • Molecular Weight
  • 42.9 kDa
  • Sequence
  • MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPYIDAEKLMCPQEIVDYIADKKDVYE

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • NDUFAB1
  • Full Name
  • NADH:ubiqui oxidoreductase subunit AB1
  • Introduction
  • Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity). Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain.
  • Alternative Names
  • ACP; ACP1; SDAP; FASN2A; acyl carrier protein, mitochondrial; CI-SDAP; NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa; NADH-ubiquinone oxidoreductase 9.6 kDa subunit; NADH:ubiquinone oxidoreductase SDAP subunit; complex I SDAP subunit; mitochondrial acyl carrier protein; CI-SDAP; NADH-ubiquinone oxidoreductase 9.6 kDa subunit

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us