Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human NDUFB11 (NADH:ubiquinone oxidoreductase subunit B11) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX1104K)

This product is a Human NDUFB11 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDUFB11
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Transport
  • TMD
  • 1
  • Sequence
  • ESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • NDUFB11
  • Full Name
  • NADH:ubiquinone oxidoreductase subunit B11
  • Introduction
  • The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to ubiquinone. Mutations in the human gene are associated with linear skin defects with multiple congenital anomalies 3 and mitochondrial complex I deficiency.
  • Alternative Names
  • NDUFB11; ESSS; Np15; P17.3; NP17.3; CI-ESSS; MC1DN30; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa; NADH-ubiquinone oxidoreductase ESSS subunit; complex I NP17.3 subunit; complex I-ESSS; neuronal protein 17.3; NADH:ubiquinone oxidoreductase subunit B11

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us