Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human NDUFB5 (NADH:ubiquinone oxidoreductase subunit B5) Full Length (CAT#: MPC4557K) Made to Order

This product is a made-to-order Human NDUFB5 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDUFB5
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • TMD
  • 1
  • Sequence
  • MAAMSLLRRVSVTAVAALSGRPLGTRLGFGGFLTRGFPKAAAPVRHSGDH
    GKRLFVIRPSRFYDRRFLKLLRFYIALTGIPVAIFITLVNVFIGQAELAE
    IPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELR
    VKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • NDUFB5
  • Full Name
  • NADH:ubiquinone oxidoreductase subunit B5
  • Introduction
  • The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Three transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • NDUFB5; SGDH; CISGDH; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa; NADH-ubiquinone oxidoreductase SGDH subunit; complex I SGDH subunit; complex I-SGDH; NADH:ubiquinone oxidoreductase subunit B5

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us