Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human NDUFS3 (NADH:ubiqui oxidoreductase core subunit S3) for Antibody Discovery (CAT#: MP0781X)

This product is a 54.56 kDa Human NDUFS3 membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDUFS3
  • Protein Length
  • Full-length
  • Molecular Weight
  • 54.56 kDa
  • Sequence
  • MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • NDUFS3
  • Full Name
  • NADH:ubiqui oxidoreductase core subunit S3
  • Introduction
  • This gene encodes one of the iron-sulfur protein (IP) components of mitochondrial NADH:ubiqui oxidoreductase (complex I). Mutations in this gene are associated with Leigh syndrome resulting from mitochondrial complex I deficiency.
  • Alternative Names
  • CI-30; MC1DN8; NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial; CI-30kD; NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa (NADH-coenzyme Q reductase); NADH dehydrogenase-ubiquinone 30 kDa subunit; NADH-ubiquinone oxidoreductase 30 kDa subunit; complex I 30kDa subunit; complex I-30kD

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us