Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human NDUFS5 (NADH:ubiqui oxidoreductase subunit S5) for Antibody Discovery (CAT#: MP0783X)

This product is a 38.9 kDa Human NDUFS5 membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDUFS5
  • Protein Length
  • Full-length
  • Molecular Weight
  • 38.9 kDa
  • Sequence
  • MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • NDUFS5
  • Full Name
  • NADH:ubiqui oxidoreductase subunit S5
  • Introduction
  • This gene is a member of the NADH dehydrogenase (ubiqui) iron-sulfur protein family. The encoded protein is a subunit of the NADH:ubiqui oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. Alternative splicing results in multiple transcript variants and pseudogenes have been identified on chromosomes 1, 4 and 17.
  • Alternative Names
  • CI15K; CI-15k; NADH dehydrogenase [ubiquinone] iron-sulfur protein 5; CI-15 kDa; NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Q reductase); NADH:ubiquinone oxidoreductase 15 kDa IP subunit; complex I-15 kDa;
    CI-15 kDa; NADH-ubiquinone oxidoreductase 15 kDa subunit

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us