Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human NECTIN1 (Nectin cell adhesion molecule 1) Expressed in NS0 for Antibody Discovery, Partial (31-334aa) (CAT#: MPX0435K)

This product is a 35.0 kDa Human NECTIN1 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NECTIN1
  • Protein Length
  • Partial (31-334aa)
  • Protein Class
  • Cell adhesion
  • Molecular Weight
  • 35.0 kDa
  • TMD
  • 1
  • Sequence
  • QVVQVNDSMYGFIGTDVVLH
    CSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFL
    RPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAKPTNWI
    EGTQAVLRAKKGQDDKVLVATCTSANGKPPSVVSWETRLKGEAEYQEIRN
    PNGTVTVISRYRLVPSREAHQQSLACIVNYHMDRFKESLTLNVQYEPEVT
    IEGFDGNWYLQRMDVKLTCKADANPPATEYHWTTLNGSLPKGVEAQNRTL
    FFKGPINYSLAGTYICEATNPIGTRSGQVEVNIT

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 300 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • NECTIN1
  • Full Name
  • Nectin cell adhesion molecule 1
  • Introduction
  • This gene encodes an adhesion protein that plays a role in the organization of adherens junctions and tight junctions in epithelial and endothelial cells. The protein is a calcium(2+)-independent cell-cell adhesion molecule that belongs to the immunoglobulin superfamily and has 3 extracellular immunoglobulin-like loops, a single transmembrane domain (in some isoforms), and a cytoplasmic region. This protein acts as a receptor for glycoprotein D (gD) of herpes simplex viruses 1 and 2 (HSV-1, HSV-2), and pseudorabies virus (PRV) and mediates viral entry into epithelial and neuronal cells. Mutations in this gene cause cleft lip and palate/ectodermal dysplasia 1 syndrome (CLPED1) as well as non-syndromic cleft lip with or without cleft palate (CL/P). Alternative splicing results in multiple transcript variants encoding proteins with distinct C-termini.
  • Alternative Names
  • NECTIN1; ED4; PRR; HIgR; HV1S; HVEC; OFC7; PRR1; PVRR; CD111; PVRL1; PVRR1; SK-12; CLPED1; nectin-1; ectodermal dysplasia 4 (Margarita Island type); herpes simplex virus type 1 sensitivity; herpes virus entry mediator C; herpesvirus Ig-like receptor; nectin 1; poliovirus receptor-like 1; poliovirus receptor-related 1 (herpesvirus entry mediator C); poliovirus receptor-related protein 1; Nectin cell adhesion molecule 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us