Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human NGB (Neuroglobin) for Antibody Discovery (CAT#: MP0793X)

This product is a 42.35 kDa Human NGB membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NGB
  • Protein Length
  • Full-length
  • Molecular Weight
  • 42.35 kDa
  • Sequence
  • MERPEPELIRQSWRAVSRSPLGHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • NGB
  • Full Name
  • Neuroglobin
  • Introduction
  • This gene encodes an oxygen-binding protein that is distantly related to members of the globin gene family. It is highly conserved among other vertebrates. It is expressed in the central and peripheral nervous system where it may be involved in increasing oxygen availability and providing protection under hypoxic/ischemic conditions.
  • Alternative Names
  • neuroglobin

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us