Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human NKAIN1 (Sodium/potassium transporting ATPase interacting 1) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX1299K)

This product is a Human NKAIN1 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NKAIN1
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Receptor
  • TMD
  • 3
  • Sequence
  • LERQIFDFLGYQWAPILANFLHIMAVILGIFGTVQYRSRYLILYAAWLVLWVGWNAFIICFYLEVGQLSQDRDFIMTFNTSLHRSWWMENGPGCLVTPVLNSRLALEDHHVISVTGCLLDYPYIEALSSALQIFLALFGFVFACYVSKVFLEEEDSFDFIGGFDSYGYQAPQKTSHLQLQPLYTSG

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • NKAIN1
  • Full Name
  • Sodium/potassium transporting ATPase interacting 1
  • Introduction
  • NKAIN1 is a member of a family of mammalian proteins with similarity to Drosophila Nkain and interacts with the beta subunit of Na,K-ATPase (ATP1B1; MIM 182330).
  • Alternative Names
  • NKAIN1; FAM77C; sodium/potassium-transporting ATPase subunit beta-1-interacting protein 1; Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 1; Na+/K+ transporting ATPase interacting 1; family with sequence similarity 77, member C; Sodium/potassium transporting ATPase interacting 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us