Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human NKAIN2 (Sodium/potassium transporting ATPase interacting 2) for Antibody Discovery (CAT#: MP0795X)

This product is a 50.2 kDa Human NKAIN2 membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NKAIN2
  • Protein Length
  • Full-length
  • Molecular Weight
  • 50.2 kDa
  • TMD
  • 4
  • Sequence
  • MGIIRFLLLYCPTNILTVCVLERQIFDFLGYQWAPILANFVHIIIVILGLFGTIQYRPRYITGYAVWLVLWVTWNVFVICFYLEAGDLSKETDLILTFNISMHRSWWMENGPGCTVTSVTPAPDWAPEDHRYITVSGCLLEYQYIEVAHSSLQIVLALAGFIYACYVVKCITEEEDSFDFIGGFDSYGYQGPQKTSHLQLQPMYMSK

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • NKAIN2
  • Full Name
  • Sodium/potassium transporting ATPase interacting 2
  • Introduction
  • This gene encodes a transmembrane protein that interacts with the beta subunit of a sodium/potassium-transporting ATPase. A chromosomal translocation involving this gene is a cause of lymphoma. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
  • Alternative Names
  • TCBA; TCBA1; FAM77B; NKAIP2; sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2; Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 2; Na+/K+ transporting ATPase interacting 2; T-cell lymphoma breakpoint-associated target protein 1; Protein FAM77B; T-cell lymphoma breakpoint-associated target protein 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us