Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human NPY1R (Neuropeptide Y receptor Y1) without tag for Antibody Discovery (CAT#: MP0805X)

This product is a 44.4 kDa Human NPY1R membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NPY1R
  • Protein Length
  • Full-length
  • Molecular Weight
  • 44.4 kDa
  • TMD
  • 7
  • Sequence
  • MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI

Product Description

  • Application
  • Antibody Production
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • NO
  • Protein Format
  • Liposome
  • Buffer
  • 25 mM Tris-HCl of pH8.0 containing 2% glycerol

Target

  • Target Protein
  • NPY1R
  • Full Name
  • Neuropeptide Y receptor Y1
  • Introduction
  • This gene belongs to the G-protein-coupled receptor superfamily. The encoded transmembrane protein mediates the function of neuropeptide Y (NPY), a neurotransmitter, and peptide YY (PYY), a gastrointestinal hormone. The encoded receptor undergoes fast agonist-induced internalization through clathrin-coated pits and is subsequently recycled back to the cell membrane. Activation of Y1 receptors may result in mobilization of intracellular calcium and inhibition of adenylate cyclase activity.
  • Alternative Names
  • NPYR; NPY1-R; neuropeptide Y receptor type 1; NPYY1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us