Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human NUS1 (NUS1 dehydrodolichyl diphosphate synthase subunit) Full Length (CAT#: MPC2713K) Made to Order

This product is a made-to-order Human NUS1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NUS1
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 3
  • Sequence
  • MTGLYELVWRVLHALLCLHRTLTSWLRVRFGTWNWIWRRCCRAASAAVLA
    PLGFTLRKPPAVGRNRRHHRHPRGGSCLAAAHHRMRWRADGRSLEKLPVH
    MGLVITEVEQEPSFSDIASLVVWCMAVGISYISVYDHQGIFKRNNSRLMD
    EILKQQQELLGLDCSKYSPEFANSNDKDDQVLNCHLAVKVLSPEDGKADI
    VRAAQDFCQLVAQKQKRPTDLDVDTLASLLSSNGCPDPDLVLKFGPVDST
    LGFLPWHIRLTEIVSLPSHLNISYEDFFSALRQYAACEQRLGK

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • NUS1
  • Full Name
  • NUS1 dehydrodolichyl diphosphate synthase subunit
  • Introduction
  • This gene encodes a type I single transmembrane domain receptor, which is a subunit of cis-prenyltransferase, and serves as a specific receptor for the neural and cardiovascular regulator Nogo-B. The encoded protein is essential for dolichol synthesis and protein glycosylation. This gene is highly expressed in non-small cell lung carcinomas as well as estrogen receptor-alpha positive breast cancer cells where it promotes epithelial mesenchymal transition. This gene is associated with the poor prognosis of human hepatocellular carcinoma patients. Naturally occurring mutations in this gene cause a congenital disorder of glycosylation and are associated with epilepsy. A knockout of the orthologous gene in mice causes embryonic lethality before day 6.5. Pseudogenes of this gene have been defined on chromosomes 13 and X.
  • Alternative Names
  • NUS1; NgBR; MRD55; CDG1AA; C6orf68; TANGO14; MGC:7199; dehydrodolichyl diphosphate synthase complex subunit NUS1; Nogo-B receptor; cis-prenyltransferase subunit NgBR; dehydrodolichyl diphosphate syntase complex subunit NUS1; di-trans,poly-cis-decaprenylcistransferase; nuclear undecaprenyl pyrophosphate synthase 1 homolog; transport and golgi organization 14 homolog; NUS1 dehydrodolichyl diphosphate synthase subunit

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us