Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human OR51C1P (Olfactory receptor family 51 subfamily C member 1 pseudogene) Full Length (CAT#: MPC3437K) Made to Order

This product is a made-to-order Human OR51C1P membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • OR51C1P
  • Protein Length
  • Full length
  • Protein Class
  • GPCR
  • TMD
  • 7
  • Sequence
  • MGSNITSTSIIFLLTGVPGLEAFHTWISIPFCFLSVTALLGNSLILFATI
    TQPSLHEPMYYFLSMLSATDLGLSISTLVTMLSIFWFNVREISFNACLSH
    MFFIKFFTVMESSVLLAMAFDRFVAVSNPLRYAMILTDSRIAQIGVASVI
    RGLLMLTPMVALLIRLSYCHSQVLHHSYCYHPDVMKLSCTDTRINSAVGL
    TAMFSTVGVDLLLILLSYVLIIRTVLSVASPEERKETFSTCVSHIVAFAI
    YYIPLISLSIVHRFGKQAPAYVHTMIANTYLLISPLMNPVIYSVKTKQIR
    RAVIKILHSKET

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • OR51C1P
  • Full Name
  • Olfactory receptor family 51 subfamily C member 1 pseudogene
  • Introduction
  • Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
  • Alternative Names
  • OR51C1P; OST734; OR51C2P; OR51C3P; olfactory receptor, family 51, subfamily C, member 2 pseudogene; olfactory receptor, family 51, subfamily C, member 3 pseudogene; Olfactory receptor family 51 subfamily C member 1 pseudogene

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us